Search Results for spanking on tumblr
Keyword Popularity
10 out of 1000
Competition Index
10 out of 1000
Keyword Advertise Index
10 out of 1000
Position | Website | Change | Thumbnail |
---|---|---|---|
1 |
spankinkandsubmission.tumblr
- Submission Spanking and really cute chicks
This space, as spanking it self, is for adults only (18 years or older), minors GTFOH. The pictures here displayed are taken from the internet and thus assumed to be of public domain. I do not claim...
|
0 | |
2 |
fuckyeahspanking.tumblr
- Spanking
#777
|
-1 | |
3 |
otkspnk.tumblr
- Spanking
Hello, just a spanking blog. I like domestic style spankings both erotic and punishment. I dont like it when they are overly rigid I think it should be kind of loving in a way. I am 25 M and I live in...
|
-3 | |
4 |
overmyknee.tumblr
- Over My Knee, Young Lady!
This is all about spanking - and spanking is for adults only! For more spanking related stuff visit the Chross Blog
|
0 | |
5 |
spankym41.tumblr
- FM OTK SPANKINGS
This is all about Spankings, Nylons and Feet those are my fetishes in that order
|
0 | |
6 | strictlyspanking.tumblr - Strictly Spanking | 0 | |
7 |
spanked2tears.tumblr
- Who's Sorry Now?
A "REAL SPANKING" only truly begins, well after the recipient is desperate for it to end...
|
0 | |
8 |
victorianspanking.tumblr
- A Libertine's Spanking.
I'm a woman. I'm a feminist. I love to be spanked.
|
-7 | |
9 |
hardhandsworld.tumblr
- Hardhands World of Spanking
All images taken from the Internet and assumed to be in the public domain, unless otherwise noted. If you believe an image infringes your rights in any way then please inform me and I will remove it...
|
0 | |
10 | myspankingaunt.tumblr - My Spanking Aunt | 0 | |
11 |
littlemissspankypantsarchive.tumblr
- Little Miss Spanky Pants Archive
A collection of photos & videos from the defunct Little Miss Spankypants Tumblr. Original Description: "a good little girlfriend who sometimes gets big spankings. 18+ NSFW" Maintained by: MasterAdrift
|
0 | |
12 |
spankingamateur.tumblr
- Amateur spankings
Early 40?s french gentleman, always passionate about spanking, caning, cp, domestic discipline and naughty french maids....living in Belgium and travelling around the world. Feel free to drop me a...
|
0 |
Related keywords by spanking on tumblr
I have no idea. Please, refresh tomorrow ;)
Most popular sites by spanking on tumblr
Sorry. Not enough data. Please, refresh tomorrow ;)
Thank you!